SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q29LP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q29LP4
Domain Number 1 Region: 893-1022
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000235
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 1061-1101
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000012
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 3 Region: 862-905
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000017
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 4 Region: 1015-1055
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000671
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  Q29LP4
Domain Number - Region: 823-862
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000496
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q29LP4
Sequence length 1306
Comment (tr|Q29LP4|Q29LP4_DROPS) Uncharacterized protein, isoform A {ECO:0000313|EMBL:EAL34001.2} KW=Complete proteome; Reference proteome OX=46245 OS=Drosophila pseudoobscura pseudoobscura (Fruit fly). GN=Dpse_GA16378 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MLKICIFTLVIAAAAAAAVTTTTTTATTTAATTTTTAATTPTKSEAPETAKQTIKNDLGG
SDAPLGAGEGNRTLLNIFKDVPEQRETATVGGSTSTATPTTTATTSTTTTEATTTTRTTK
TAPTTPTSTSTTENEVASGGSMLMTTALPPADLGEMSGIKDAVHRIKLSVIPSSSTTEQA
EVALEMKQQSKVAPEEMKVATIELKEQPAAPIEEAPEGDEDIPTESPLQIQMQAAASYQV
AETLADLNEEERARYDAMLAHQPTASKLNIVDLYPLKIEDFQPIIQNDNEELLRQRTIFT
QPENNEEYRQNLMPNEVDMVINRDEELVREKLRVNQAIGDTTTTPIASQGTTADFTGKLL
ADQDDLITEIESKFQLQETTTTTTTTTTTAPKATTTTVRTPSLLKPGDSFIDRRVKKSFE
FPMQHRASDVMAMPHIDFANTKFQTDSLDSSVDGKAAVGSAMHMASHPEFSTTKFYNSKE
LYNEMLLHNKRKLMKETKSTTTMGASGAAESPVVKSVEDTTQLPLSVTLVADGQTFSPTT
TAAAPATPTISPATTPATAEAAAADSTTKTTSAVGNSGKYQKQLKRAKLLLKALTPPKPD
KLAVVSSPVKVATEPSPSPSPSSTTMATTPGPMMAMARTRPRPQRPVNPAKAASKPIARP
RILSRLQEKINSLECEIQNVPQDSHLWRGNETHELLLPIVTTEHCRPDEHCIPNVLTWRG
ESEIQSGDILIVEINDAMLNPSHQPNNTSSAVHATQVYQVTRSGHEHCDVTEGVLLDITP
LVVDGRKLVTLYDKDLTEGVNLLIVVSELWGAQCVRLKVTTKTDNCGENADCSGKGVCYS
NAGMEEYECQCCSGFAGPHCEEIDACNPSPCTNNGICVDLSQGHEGNSYQCLCPYGYAGK
NCQYESDPCNPAECMNGGSCVGNSTHFRCDCTPGFTGPLCQHSLNECESSPCVHGICVDQ
EDGFRCFCQPGFAGELCNFEYNECESNPCQNAGECIDHIGSYECHCTKGYTGNRCQIKVD
FCANKPCPEGHRCMDHGNDFSCECPGGRNGPDCNQMPRTYFQQCQVNPCTHGGTCWSSGE
SFYCACRPGYTGTMCEDEFVVETVVSSSEFIVDDANARNFNDKTFGSSVVLKSPIELHNA
YFAAGVLAAAIFIVAVVVTICHCKVNQTYRKFSTRSTSFIPILGFSRRPKMQGKLNKHWL
SGKGPNGPGQPGTSSSSGGGGAAGPSSGGAQRGSLTGATTHSMRHLPSHPQTQTSLGSGA
TGGSNNCGAAGGGQLQERPFQRHLAMNLENDMYYTVENSQHSPLIQ
Download sequence
Identical sequences Q29LP4
7237.FBpp0280796 FBpp0280796 XP_001356935.2.19638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]