SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q2HD57 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q2HD57
Domain Number 1 Region: 25-267
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.75e-42
Family Carboxylesterase 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q2HD57
Sequence length 275
Comment (tr|Q2HD57|Q2HD57_CHAGB) Uncharacterized protein {ECO:0000313|EMBL:EAQ93612.1} KW=Complete proteome; Reference proteome OX=306901 OS=6347 / NRRL 1970) (Soil fungus). GN=CHGG_01847 OC=Chaetomium.
Sequence
MAAPPTAPTALIYPSHVPANARTDVPRPSQFHFKDYEELIIPTNDGEKLSAFYIRGPRGG
PNSKVTVLMFHGNAGNIGHRLPIARMLIAASGCNVFMLEYRGYGISTGEPDESGLNIDAQ
TALDYLRDRAETRAHKIVVYGQSLGGAVGIRLVAKNQASADISGLILENTFLSMRKLIPS
IMPPAKYLAYLCHQVWPSDSLIPSIKVPTLFLSGLQDELIPPIHMKRLHDLSKAPIKVWK
PLPGGDHNSSVVEDGYFEAIVDFMNRIVAADGEKQ
Download sequence
Identical sequences Q2HD57
XP_001221068.1.25026 CHGT_01847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]