SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q2HZ94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q2HZ94
Domain Number 1 Region: 349-489
Classification Level Classification E-value
Superfamily C-type lectin-like 6.12e-41
Family C-type lectin domain 0.00023
Further Details:      
 
Domain Number 2 Region: 786-925
Classification Level Classification E-value
Superfamily C-type lectin-like 1.86e-37
Family C-type lectin domain 0.00035
Further Details:      
 
Domain Number 3 Region: 645-779
Classification Level Classification E-value
Superfamily C-type lectin-like 4.39e-37
Family C-type lectin domain 0.000000209
Further Details:      
 
Domain Number 4 Region: 932-1082
Classification Level Classification E-value
Superfamily C-type lectin-like 1.35e-36
Family C-type lectin domain 0.0004
Further Details:      
 
Domain Number 5 Region: 22-153
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.24e-34
Family Cysteine rich domain 0.000000275
Further Details:      
 
Domain Number 6 Region: 1220-1358
Classification Level Classification E-value
Superfamily C-type lectin-like 1.6e-33
Family C-type lectin domain 0.00027
Further Details:      
 
Domain Number 7 Region: 500-638
Classification Level Classification E-value
Superfamily C-type lectin-like 1.43e-31
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 8 Region: 229-344
Classification Level Classification E-value
Superfamily C-type lectin-like 8.59e-30
Family C-type lectin domain 0.0008
Further Details:      
 
Domain Number 9 Region: 1088-1217
Classification Level Classification E-value
Superfamily C-type lectin-like 2.06e-28
Family C-type lectin domain 0.0019
Further Details:      
 
Domain Number 10 Region: 153-211
Classification Level Classification E-value
Superfamily Kringle-like 9.71e-20
Family Fibronectin type II module 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q2HZ94
Sequence length 1456
Comment (tr|Q2HZ94|Q2HZ94_MOUSE) Mannose receptor, C type 1 {ECO:0000313|EMBL:AAI41339.1} OX=10090 OS=Mus musculus (Mouse). GN=Mrc1 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MRLLLLLAFISVIPVSVQLLDARQFLIYNEDHKRCVDALSAISVQTATCNPEAESQKFRW
VSDSQIMSVAFKLCLGVPSKTDWASVTLYACDSKSEYQKWECKNDTLFGIKGTELYFNYG
NRQEKNIKLYKGSGLWSRWKVYGTTDDLCSRGYEAMYSLLGNANGAVCAFPFKFENKWYA
DCTSAGRSDGWLWCGTTTDYDKDKLFGFCPLHFEGSERLWNKDPLTGILYQINSKSALTW
HQARASCKQQNADLLSVTEIHEQMYLTGLTSSLSSGLWIGLNSLSVRSGWQWAGGSPFRY
LNWLPGSPSSEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNNTLNPFIIPSASDVPT
GCPNQWWPYAGHCYRIHREEKKIQKYALQACRKEGGDLASIHSIEEFDFIFSQLGYEPND
ELWIGLNDIKIQMYFEWSDGTPVTFTKWLPGEPSHENNRQEDCVVMKGKDGYWADRACEQ
PLGYICKMVSQSHAVVPEGADKGCRKGWKRHGFYCYLIGSTLSTFTDANHTCTNEKAYLT
TVEDRYEQAFLTSLVGLRPEKYFWTGLSDVQNKGTFRWTVDEQVQFTHWNADMPGRKAGC
VAMKTGVAGGLWDVLSCEEKAKFVCKHWAEGVTRPPEPTTTPEPKCPENWGTTSKTSMCF
KLYAKGKHEKKTWFESRDFCKAIGGELASIKSKDEQQVIWRLITSSGSYHELFWLGLTYG
SPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPGMSWNDINCEHLNNWICQIQ
KGKTLLPEPTPAPQDNPPVTADGWVIYKDYQYYFSKEKETMDNARAFCKKNFGDLATIKS
ESEKKFLWKYINKNGGQSPYFIGMLISMDKKFIWMDGSKVDFVAWATGEPNFANDDENCV
TMYTNSGFWNDINCGYPNNFICQRHNSSINATAMPTTPTTPGGCKEGWHLYKNKCFKIFG
FANEEKKSWQDARQACKGLKGNLVSIENAQEQAFVTYHMRDSTFNAWTGLNDINAEHMFL
WTAGQGVHYTNWGKGYPGGRRSSLSYEDADCVVVIGGNSREAGTWMDDTCDSKQGYICQT
QTDPSLPVSPTTTPKDGFVTYGKSSYSLMKLKLPWHEAETYCKDHTSLLASILDPYSNAF
AWMKMHPFNVPIWIALNSNLTNNEYTWTDRWRVRYTNWGADEPKLKSACVYMDVDGYWRT
SYCNESFYFLCKKSDEIPATEPPQLPGKCPESEQTAWIPFYGHCYYFESSFTRSWGQASL
ECLRMGASLVSIETAAESSFLSYRVEPLKSKTNFWIGMFRNVEGKWLWLNDNPVSFVNWK
TGDPSGERNDCVVLASSSGLWNNIHCSSYKGFICKMPKIIDPVTTHSSITTKADQRKMDP
QPKGSSKAAGVVTVVLLIVIGAGVAAYFFYKKRHALHIPQEATFENTLYFNSNLSPGTSD
TKDLMGNIEQNEHAII
Download sequence
Identical sequences Q2HZ94 Q61830
ENSMUSP00000028045 ENSMUSP00000028045 NYSGRC-LECT-ENSMUSP00000028045 ENSMUSP00000028045 NP_032651.2.92730 10090.ENSMUSP00000028045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]