SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q2K7Y0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q2K7Y0
Domain Number 1 Region: 8-179
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.84e-35
Family YdeN-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q2K7Y0
Sequence length 185
Comment (tr|Q2K7Y0|Q2K7Y0_RHIEC) Hypothetical conserved protein {ECO:0000313|EMBL:ABC91056.1} KW=Complete proteome; Reference proteome OX=347834 OS=Rhizobium etli (strain CFN 42 / ATCC 51251). GN=RHE_CH02276 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Rhizobium.
Sequence
MKASDADILIIPGYTNSGPGHWQSRWQAKLSTARRVEQAEWTKPVREDWIARIAEEVNAS
TRPVVLIAHSLGAPSAIHAIPRFRKRVAGAFLVAPPDVTNPDIRPKHLMTFGPYPRDPLP
FPSITVASRNDPFGSYEHADDMASSWGSFLVDAGEAGHINADSGHGPWPEGTMVFAQFLS
RLSAD
Download sequence
Identical sequences Q2K7Y0
WP_011425536.1.62937 gi|86357891|ref|YP_469783.1| 347834.RHE_CH02276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]