SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q2KN93 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q2KN93
Domain Number 1 Region: 1026-1130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.44e-32
Family Calponin-homology domain, CH-domain 0.0001
Further Details:      
 
Weak hits

Sequence:  Q2KN93
Domain Number - Region: 571-782
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0238
Family HBL-like 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q2KN93
Sequence length 1132
Comment (sp|Q2KN93|CYTSA_DANRE) Sperm antigen with calponin homology and coiled-coil domains 1-like KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=im:7159316, OC=Cyprinidae; Danio.
Sequence
MKKAGRPVGNKAASGGGKGDSVTAGNCAGKNTVKSPTSAPLSKVKSNDDLLAAMAGSSAG
TNNSVAKGKKSTSTHSTSCGTNTNNPDTKTKTTSGPSGKRTTSMTSKESNSSRERLRNSR
NSSSKKQSSTGASDRAQPKHSRALAQTSDSESRMSKSKSDGQLSDKVALEAKVKNLLGLA
KSKDVEILQLRGELRDMRVQLGLPEEDEEEERPPEREAAAVITAADVESTLLLLQEQNQA
IRGELNLLKNENRMLKDRLNALGFSLEQRLDGADKTFGFPSTSPELSSGGAGAHGDCATV
ASSVEGSAPGSMEDLLTGGQRSGSTDNLDSESSEVYQAVTSSDDALDAPSGCGSSSSSES
EGGPPACRSSSRKGSSGNTSEVSVACLTERIHQMEENQHSTSEELQATLQELADLQQITQ
ELNGENERLGEEKVLLMDSLCQQSDKLEHCGRQIEYFRSLLDEHGVAYSVDEDIKSGRYM
ELEQRYVELAENARFEREQLLGVQQHLSNTLKMAEQDNAEAQNVIAALKERNHHMERLLD
VERQERASMAAVLEECKAAVNNDQAELSRCRVLLEQERQKVAELYSIHNAGDKSDIHQLL
EGVRLDKEEAEAKASKLQDDLGHARSEVACLQDTLNKLDAEYRDFQSVVQKELAEQKRAI
EKQREDLQEKETEIGDMKETIFELEDEVEQHRAVKLHDNLIISDLENSMKKLQDQKHDME
REIKILHRRLREESAEWRQFQADLQTAVVIANDIKSEAQEEIGDLRRRLQEAQEKNEKLG
KEIEEVKNRKQDEERGRVYNYMNAVERDLAALRQGMGLSRRPSTSSEPSPTVKTLIKSFD
SASQGPGANATAVAAAAAAAAAAAAVTVTSTTPTAPLPRTPLSPSPMKTPPAAAVSPIQR
HSITGSMAAAKPLSSLADKRPSYTDISMPAEHLLRAANSRPASALQRVSNMDTSKTITVS
RRSSEEPKRDISTPDGGPASSLISMSSAAALSSSSSPTASVNPTARSRLREERKDPLSAL
AREYGGSKRNALLRWCQKKTEGYQNIDITNFSSSWNDGLAFCAVLHTYLPAHIPYQELNS
QDKRRNFTLAFQAAESVGIKSTLDITDMVHTERPDWQSVMTYVTSIYKYFET
Download sequence
Identical sequences Q2KN93
ENSDARP00000010292 7955.ENSDARP00000010292 XP_005167234.1.45394 ENSDARP00000010292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]