SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q2LK95 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q2LK95
Domain Number 1 Region: 151-273
Classification Level Classification E-value
Superfamily C-type lectin-like 2.45e-34
Family C-type lectin domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q2LK95
Sequence length 277
Comment (sp|Q2LK95|COL10_CHICK) Collectin-1 KW=Complete proteome; Reference proteome OX=9031 OS=Gallus gallus (Chicken). GN=COLEC10; OC=Phasianidae; Phasianinae; Gallus.
Sequence
MSRKKEQQLRKYGTLVVLFIFQVQIFGFDVDNRPTTDVCSTHTILPGPKGDDGEKGDRGE
VGKQGKVGPKGPKGNKGTVGDVGDQGMLGKIGPIGGKGDKGAKGISGVSGKKGKAGTVCD
CGRYRRVVGQLNINVARLNTSIKFVKNVIAGIRETDEKFYYIVKEEKNYREALMHCRDRG
GTLAMPKDEVTNALLADYISSSGLFRAFIGLNDMEKEGQFVYADSSPLQNYSNWKDGEPH
DSTGHEDCVEMLSTGEWNDSECQVTIYFICEFLKKRK
Download sequence
Identical sequences Q2LK95
NP_001034687.1.86415 ENSGALP00000043336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]