SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q2LXC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q2LXC8
Domain Number 1 Region: 341-395
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000000383
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q2LXC8
Sequence length 769
Comment (tr|Q2LXC8|Q2LXC8_SYNAS) Kunitz/bovine pancreatic trypsin inhibitor domain protein {ECO:0000313|EMBL:ABC78742.1} KW=Complete proteome; Reference proteome OX=56780 OS=Syntrophus aciditrophicus (strain SB). GN=SYN_02414 OC=Syntrophaceae; Syntrophus.
Sequence
MKKSDTSHQMPMLSVIPTQIILLWIAFLIMIILPTPIQADMGRVVATEAQVSEDSQKAII
LHNREEEVLILGTDLKADKSARIIRFIPFPEEPKVQLASPASFESAMDLIKKHGLKFIEQ
TKGGRAAARAVEMRFNQRLGSHDVTVIRINDAAEFNGWVREFLRQKGLQLKREDPKIEAV
VRDYTRRGFVWFVFDFVTVNEQIRFVEPIQYRFKTKELYYPLKTSNTFGGSGMIDLILIT
PGTFCEPLQSYYGGCFGFQEMRATTSSQLENDEMKGIFPGIGQFSKNQNMFIQLMRYQGD
YEFDQDLLGDFGQAVPYAIGHVEEAWGSPWLFPMEENVKDLKERCRLKPDSGPCKAIFWR
YFFNPETQKCEKFVYGGCEGTVPFETKEECVALCEKDGGASSTLKNINFEEFTPSSKHFT
LQIPAGWPREEYDIQRSSLLSGNNKYELTVRAPGQEGLEYLSVRVAWHRDACGTPERFIY
DLLNPRFSSRRADAKVLPLTGPEAKTLEIKKVRQPFQGMNAKPVKAIERYVVIPAHTGFY
VLVYDAPEALFKENKWVFDKILSSFQPMVSLNSKPEPVAEVSDDEYEVYADFFSAEEVRG
FEIPPYFSNTYRARHVYHETSAGKNSDKQTLTHLMESFGALDKSIMEDYREKNKRVRILR
DRMVVPWLEILQTNEPNREGGRGMEQPLTVFPDEVFLSRIGFNEQKDTALFYVSQNGAPM
TGYFVLMVKKKNRWVIKNAVLEDFKIPYSEISPSFQYIQHDISDGKGGR
Download sequence
Identical sequences Q2LXC8
56780.SYN_02414 gi|85860708|ref|YP_462910.1| WP_011418758.1.90099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]