SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q2NKZ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q2NKZ7
Domain Number 1 Region: 91-253
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.99e-32
Family Dual specificity phosphatase-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q2NKZ7
Sequence length 270
Comment (tr|Q2NKZ7|Q2NKZ7_BOVIN) Protein tyrosine phosphatase, mitochondrial 1 {ECO:0000313|EMBL:AAI11307.1, ECO:0000313|Ensembl:ENSBTAP00000039412} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=PTPMT1 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MVWVPGAPGGPGDSPGAGPEVATLERPAPAGSSSLGAAAASPPPWPGPRSPASCPAVGGS
PLRRAGWAGMAAGTLLEAGLARVLYYPTLLYTVFRGKMPGRAHRDWYHRIDSTVLLGALP
LRSMTRRLVQDENVRGVITMNEEYETRFLCNSSKEWEKAGVEQLRLSTVDMTGVPTLANL
QKGVQFTIRHQSLGHSVYVHCKAGRSRSATMVAAYLIQVYHWTPEEAIRAITKIRSHIYI
RPGQLEVLKEFHKVTTAGAAKTEIHHTPLT
Download sequence
Identical sequences Q2NKZ7
ENSBTAP00000039412 9913.ENSBTAP00000039412 ENSBTAP00000039412 NP_001069821.1.59421 NP_001069821.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]