SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q2PG26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q2PG26
Domain Number 1 Region: 1-66
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.94e-19
Family Glutathione peroxidase-like 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q2PG26
Sequence length 69
Comment (tr|Q2PG26|Q2PG26_MACFA) Macaca fascicularis brain cDNA clone: QflA-16029, similar to human glutathione peroxidase 4 (phospholipidhydroperoxidase) (GPX4), mRNA, RefSeq: NM_002085.1 {ECO:0000313|EMBL:BAE89004.1} KW=Complete proteome; Reference proteome OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=EGM_09008 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLV
IEKDLPHYF
Download sequence
Identical sequences Q2PG26 Q6PJX4
ENSMMUP00000032020 ENSMMUP00000032020 9544.ENSMMUP00000032020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]