SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q2QTR4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q2QTR4
Domain Number 1 Region: 376-747
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.96e-116
Family Oxysterol-binding protein 0.00049
Further Details:      
 
Domain Number 2 Region: 56-86,122-180
Classification Level Classification E-value
Superfamily PH domain-like 3.68e-20
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q2QTR4
Sequence length 756
Comment (tr|Q2QTR4|Q2QTR4_ORYSJ) cDNA clone:J023007B17, full insert sequence {ECO:0000313|EMBL:BAG91255.1} KW=Complete proteome; Reference proteome OX=39947 OS=Oryza sativa subsp. japonica (Rice). GN=OsJ_35782 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MNPLCCIAPVSLDSAVEHHHQPPRILAAAAAAPTSPTPPAAAVAAQVVLDAAQAAVAGVL
HKWVNYGKGWRLRWFVLEGGVLSYYKLRVGGGGDSAASPAVAARVIGEGGALRRAREEAA
AAGKQWKPFGEIHLKVSSIRASKSDDKRLYIFSGTKTLHLRCETEEDRNAWIQALQAAKD
RFPRSLTSNDFSPMSDVLLSTEKLRVRLLQEGLNETVVKECESIMMTELLELHNQMKSQQ
QQYSILIDRLRQLETEKVELERTVVHETKEREAHGYANGRYSDFYSVLSGGSASESDPDT
ASQVADVETDEDEVMYFDTRDFLSAESLRSASCRRRELLTNGCNGLEHTDPAANVVKTTQ
YPSVKRRDKLPEPKEKENPVGLWSIIKENIGKDLSGVCLPVYFNEPLSSLQKCFEDLEYS
YLVDHALQWGKQGDSLMRTLHVAAFAVSGYASTEGRQCKPFNPLLGETYEADYPDKGLRF
FSEKVSHHPMVVACHCEGRGWKFWGDSNLKGKFWGRSIQLDPIGVLTLQFDDGETFQWSK
VTTSIYNIIIGKIYCDHYGTMRIKGSGDYSCKLKFKEQSIIDRNPHQVHGFVQDNRTGQK
VAMLIGKWDEAMYYVLGDPSAKPKGYDPMSEAVLLWERDKSLNQTRYNLSPFAISLNELT
ANLAKKLPPTDSRLRPDQRHLENGEYEMANAEKLRLEQLQRQARRLQEKGWQPRWFSKDD
DDSYRYIGGYWEAREKGNWDGIPDIFGQRSASPGWS
Download sequence
Identical sequences Q2QTR4
LOC_Os12g18770.1|PACid:21935711 39947.LOC_Os12g18770.1 LOC_Os12g18770.1|13112.m02001|protein XP_015620678.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]