SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q2QYC6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q2QYC6
Domain Number - Region: 397-443
Classification Level Classification E-value
Superfamily PH domain-like 0.0102
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q2QYC6
Sequence length 475
Comment (tr|Q2QYC6|Q2QYC6_ORYSJ) cDNA clone:J023077I15, full insert sequence {ECO:0000313|EMBL:BAG92267.1} KW=Complete proteome; Reference proteome OX=39947 OS=Oryza sativa subsp. japonica (Rice). GN=OSNPB_120124400 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MPPRARTLLMPLAAATLLVASTIFLFAATGARWRPADTGLPVPAADFSAAVLESAVTDTT
AAAKELSFVDENGRPDDPASSSAAAARCDPTHAAVRVFMYDLPPEFHFGILGWSPPTDGA
ADAAMWPDVGSGAAAPRYPGGLNQQHSVEYWLTLDLLSSSSPPCGAAVRVADSRDADVVF
VPFFASLSYNRHSRVVPPEKVSRDKELQEKLVRYLMAQPEWKRSGGADHVIVAHHPNSLL
HARSVLFPVVFVLSDFGRYHPRVASLEKDVIAPYKHMAKTFVNDSAGFDDRPTLLYFRGA
IFRKEGGNIRQELYYMLKDEKDVYFAFGSVQDHGASKASKGMHASKFCLNIAGDTPSSNR
LFDAIVSHCVPVIISDDIELPYEDALDYSKFSIFVRSSDAVKKGYLMRLIRGVSKHQWTR
MWNRLKEVDKHFEYQYPSQKDDAVQMIWQALARKVPAIRLKSHRSRRFSRYDRGK
Download sequence
Identical sequences B8BLT2 Q2QYC6
OsIBCD033920 39946.BGIOSIBCE035588 39947.LOC_Os12g03100.1 LOC_Os12g03100.1|PACid:21935202 XP_015620647.1.37577 LOC_Os12g03100.1|13112.m00265|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]