SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q2T9Q1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q2T9Q1
Domain Number 1 Region: 44-205
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.23e-26
Family Ypt/Rab-GAP domain of gyp1p 0.0072
Further Details:      
 
Domain Number 2 Region: 186-302
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.52e-16
Family Ypt/Rab-GAP domain of gyp1p 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q2T9Q1
Sequence length 403
Comment (sp|Q2T9Q1|TBC20_BOVIN) TBC1 domain family member 20 KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=TBC1D20; OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MALRSARGDGPTSGRWDGGAEKGDFNAKRKKKVAEIYQALNSEPTDVAALRRMAISEGGL
LTDEIRRKVWPKLLNVNTNDPPPISGKNLRQMSKDYQQVLLDVRRSLRRFPPGMPEEQRE
GLQEELIDIILLILERNPQLHYYQGYHDIVVTFLLVLGERLATSLVEKLSTHHLRDFMDP
TMDNTKHILNYLMPIIDQVNPELHDFMQSAEVGTIFALSWLITWFGHVLSDFRHVVRLYD
FFLACHPLMPIYFAAVIVLYREQEVLDCDCDMASVHHLLSQIPQDLPYETLISRAGDLFV
QFPPSELAREAAAQPQAEKTAASTFKDFELASAQQRPDMVLRQRFRGLLRPDERTKDVLT
KPRTNRFVKLAVMGLTVALGAAALAVVKSALEWAPKFQLQLFP
Download sequence
Identical sequences Q2T9Q1
9913.ENSBTAP00000017725 ENSBTAP00000017725 ENSBTAP00000017725 NP_001033118.1.59421 NP_001033118.1.76553 XP_010840071.1.44457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]