SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q2T9R2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q2T9R2
Domain Number - Region: 31-111
Classification Level Classification E-value
Superfamily EF-hand 0.00193
Family Calmodulin-like 0.018
Further Details:      
 
Domain Number - Region: 191-344
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0178
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q2T9R2
Sequence length 525
Comment (sp|Q2T9R2|KASH5_BOVIN) Coiled-coil domain-containing protein 155 KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=CCDC155; OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MDMPEDQAGGPTAKMYLWDQAEDRSLGTLLSLEEQILNSTFEACDPQRTGTVAVTHLLAY
LEAVTGRGPQDARLQTLACSLDPSGEGPQATVDLDTFLVVMRDWITACQLDGGLELEEET
AFEGALTSQQLPSGCPEVEDPANLESFGGEDPRPELPATADLLSSLEDLELSNRRLAGEN
AKLQRSVETAEEGSARLGEEISALRKQLRSTQQALQLARGVDEELEDLKTLAKSLEEQNR
SLLAQARHTEKEQQRLVAEMETLQEENGKLLAERDGVKRRSEELASEKDILKRQLYECEH
LICQRDAILSERTRHAESLTKTLEEYRATTQELRLEISHLEEQLSQTQEGLDELSEGAQV
RRVDCTNLLPPSLGVELQAIQQRNLQEESAHPQEGREEPSTRLPRREEEDGAEIQVMVDL
PLHPEDSHPGDILGNPPESSPSEPELQQALVPMVKELVPVRRPVWGQLCLWPLHLRRLRV
TRHLLIPAPLLGLLLLLLLSVLLLGQSPPPTWPHLQLCYLQPPPV
Download sequence
Identical sequences Q2T9R2
9913.ENSBTAP00000040719 ENSBTAP00000040719 ENSBTAP00000040719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]