SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q2T9Y2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q2T9Y2
Domain Number 1 Region: 32-309
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.18e-74
Family Eukaryotic proteases 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q2T9Y2
Sequence length 366
Comment (tr|Q2T9Y2|Q2T9Y2_BOVIN) LOC529047 protein {ECO:0000313|EMBL:AAI11211.1} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=LOC529047 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
QSDRRCRTGRMDITAAEGLGPGWKVACMLAVVLLCLHSLLPHTKVAGTTDGPPVSAVSSC
GKTAVTGKIIGGKNTVDKRWPWQAGLLYQGMFICGASLISDYWVISAAHCFQMSHKPSDY
KILLGYYQLEKPTSYSQLAAVYRLFIHADYNKHYYQESDITLLQLYRPAKFSDSIRTVCL
PEVNIQLLDLILCWITGWGMVNDQELLPTPRTLQEAQVGFLDNSFCESILKPPETINQTI
AIQDGMLCAADFLAGKSVCRGDSGGPLVCKLNDTWYLMGLASFSTPCEKPIGPGIFTKVS
YFNQWITEKQKSSPNPDPSTAPPEEKPPALFSFNSLGNVHKPRNFLVLVASQTFLLLLIF
LWTMGL
Download sequence
Identical sequences L8IV52 Q2T9Y2
ENSBTAP00000012471 ENSBTAP00000012471 9913.ENSBTAP00000012471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]