SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q2UR64 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q2UR64
Domain Number 1 Region: 3-279
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.85e-58
Family Proline iminopeptidase-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q2UR64
Sequence length 286
Comment (tr|Q2UR64|Q2UR64_ASPOR) Uncharacterized protein {ECO:0000313|EMBL:BAE55951.1} KW=Complete proteome; Reference proteome OX=510516 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) (Yellow koji mold). GN=AO090005000954 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MVEFVTINGAQLAYRLAGPANAPLIVTLHGGRGFGDHKSDFHAFLPLSPDYRLLSFDFRG
HGRSSRTEPYSFRQLVEDIEGLRRHFVGGENPCIVCGGSFGGFLAQQYAITYPSHVSHLI
LRGTAPSHHHEAEAIEVLEGRMHRAPGLSTRMLRDKIFGQFDSDLEFQLIMYAAAPLYSE
SFNADIALGRNLDTVFYAKSHNDLYAEPEKFFDYRDDLSTVTAKTLIIVGERDWICPPAQ
SRVIASLIPNAHLEVIQDANHSVHVEKNAEVIGHIRKHLMRPAAIS
Download sequence
Identical sequences A0A1S9DUX6 I8A9B5 Q2UR64
AO090005000954 5062.CADAORAP00002849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]