SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q2UZW7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q2UZW7
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.3e-51
Family Calponin-homology domain, CH-domain 0.00000035
Further Details:      
 
Domain Number 2 Region: 201-263
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 8.37e-22
Family EB1 dimerisation domain-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q2UZW7
Sequence length 281
Comment (tr|Q2UZW7|Q2UZW7_MOUSE) Microtubule-associated protein {ECO:0000313|EMBL:AAQ05030.1} OX=10090 OS=Mus musculus (Mouse). GN=EB3 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRK
VKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYD
GKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAP
PCILRKNPPSARNGGHEADAQILELNQQLLDLKLTVDGLEKERDFYFSKLRDIELICQEH
ESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDEY
Download sequence
Identical sequences G3GXR7 Q2UZW7 Q5XIT1 Q6PER3
ENSRNOP00000011877 ENSMUSP00000031058 10090.ENSMUSP00000031058 10116.ENSRNOP00000011877 ENSMUSP00000031058 NP_001007657.1.100692 NP_001007657.1.4139 NP_579928.1.92730 XP_003497080.1.69978 XP_004686431.1.23501 XP_006503686.1.92730 XP_007470873.1.90284 XP_007613661.1.28591 XP_008762734.1.100692 ENSRNOP00000011877 ENSMUSP00000031058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]