SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q2V8H2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q2V8H2
Domain Number 1 Region: 19-292
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.04e-50
Family Aclacinomycin methylesterase RdmC 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q2V8H2
Sequence length 296
Comment (tr|Q2V8H2|Q2V8H2_ECOLX) Putative esterase {ECO:0000313|EMBL:ABB89110.1} OX=562 OS=Escherichia coli. GN=estX OC=Enterobacteriaceae; Escherichia.
Sequence
MLTNKMLYVKLEGNFSMKEKVVVDKAISLYTESFGDPAHEPIILIMGAMSSAVWWPDEFC
SQLAKMGRCVIRYDHRDTGKSTSYEPGQAPYSVEELADDVVRVIDGYGLEAAHLVGMSLG
GFLSQLVALKYPKRVKSLTLIASERLADADPDMPAFDPAIIEYHQRAESLDWSNRDAVVA
YQVGAWRINSGTAHAFDAEKIQNIAELNFDRTPNILTTFNHTTLGGGERWLGRLNEIAVP
TLIIHGTEDPVLPYVHGLALKDAIRGSKMLTLEGTGHELHHEDWPRIIQAIKGQTS
Download sequence
Identical sequences Q2V8H2 U5Q1C2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]