SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q2VZQ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q2VZQ4
Domain Number 1 Region: 3-146
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.62e-54
Family Ribonuclease PH domain 1-like 0.0000226
Further Details:      
 
Domain Number 2 Region: 297-489
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.43e-48
Family Ribonuclease PH domain 1-like 0.0000127
Further Details:      
 
Domain Number 3 Region: 451-548
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.77e-27
Family Ribonuclease PH domain 2-like 0.00013
Further Details:      
 
Domain Number 4 Region: 140-233
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.41e-26
Family Ribonuclease PH domain 2-like 0.0015
Further Details:      
 
Domain Number 5 Region: 555-641
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.17e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0021
Further Details:      
 
Domain Number 6 Region: 621-703
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.02e-21
Family Cold shock DNA-binding domain-like 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q2VZQ4
Sequence length 720
Comment (sp|Q2VZQ4|PNP_MAGSA) Polynucleotide phosphorylase {ECO:0000255|HAMAP-Rule:MF_01595} KW=Complete proteome; Reference proteome OX=342108 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264). GN=pnp OC=Rhodospirillaceae; Magnetospirillum.
Sequence
MSMFNVHRKEITWGGRKLVLETGKVARQADGAVMVTYGETSVLCTVVGAKSQKPGIDFFP
LTVNYQEKAFAAGKIPGGFFKREGRPSEKETLVSRLIDRPIRPLFADGFRNEVQVVCTVL
SHDLENDPDIAALVGTSAALTISGLPFMGPVGAARVGYVDGAYVLNPLVGDLPKSELDLV
VAGTVEGVLMVESEAKQLSEDVMLGAVMFGHREFQAVIQAIIDLAEECAKDPWDLPEPPA
EVAVVTGKFNDAGVPAELAEAYKIIKKQDRYAAVGAVKKKALALLTEAAEIAVAGGILKH
LEADVVRGNILKTGVRIDGRDTKTVRAIEVEVGVLPRAHGSALFTRGETQALVVATLGTG
QDEQIIDQLAGEYREHFMLHYNFPPYSVGEAGRMGSPGRREIGHGKLAWRAMRPCLPAKE
SFPYTMRVVSEITESNGSSSMASVCGSSLALMDAGVPLPKPVAGIAMGLIKEGTDFAVLS
DILGDEDHLGDMDFKVAGTVDGVTALQMDIKITSITEEIMKIALGQAKDGRIHILGEMNK
GLDHARDSVSGNAPRITTISIPKEKIREVIGTGGKVIREICEQTGAKIDIDDDGTIKVAS
VDADAAQRAIDWIRGIVAEPELGVIYNGKVVKVVDFGAFVNFLGSRDGLVHISELARERV
AKTADVVKQGDVVKVKVLGFDDRGKVKLSMKQVDQTTGEDISAQLEAERAASKRERHHED
Download sequence
Identical sequences Q2VZQ4
342108.amb4117 gi|83313216|ref|YP_423480.1| WP_011386466.1.61852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]