SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q2YDE2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q2YDE2
Domain Number - Region: 183-208
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0614
Family Classic zinc finger, C2H2 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q2YDE2
Sequence length 247
Comment (sp|Q2YDE2|SPT46_BOVIN) Spermatogenesis-associated protein 46 KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=SPATA46; OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MENFSLLSISGTRISSSALSTLPDIMSSRATSLPDIAKPVLPTEVPSPVQALPPQCPGGV
LRHGVHNIVISPDCILGDAPNGEQLRWNCTIYRPWFSPYSYFLCKDKESHLETYSFSEVQ
RDEGQRDSCLPEDTADSVCSSSPSPENTCPREATKKSRPGPDTTDSITFQDILMASKWHP
AQQNGYKCASCCRLYPTLHSLKSHIKRGFKEGFSCKVYYHKLKTLWYKEQKARPGDRLSL
GSGQAFR
Download sequence
Identical sequences Q2YDE2
ENSBTAP00000013422 ENSBTAP00000013422 NP_001039925.1.59421 NP_001039925.1.76553 9913.ENSBTAP00000013422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]