SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q30BY6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q30BY6
Domain Number 1 Region: 22-243
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.43e-55
Family Xylanase/endoglucanase 11/12 0.0000296
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q30BY6
Sequence length 260
Comment (tr|Q30BY6|Q30BY6_PHYRM) Cell 12A endoglucanase {ECO:0000313|EMBL:ABB22035.1, ECO:0000313|EnsemblProtists:Phyra83138} KW=Complete proteome; Reference proteome OX=164328 OS=Phytophthora ramorum (Sudden oak death agent). GN=EGL12-D OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MKLLLAATSVAVVATSAFAQKEMCGDWDTAEVGDYTLYNNLWGKDNDPGTGHQCTTLLNS
TADNSTLGWSSNYKWGGITWNVKGYPNVGLQFKPIELANVESIPTTINYTYEYEPTTTAN
VAYDLFTSSTPDGEFEFEIMVWLAAIGTAWPLSSEGKQIKNITVSGVEFTLNHGINGNMT
VFSYVASEITENFSGDLVEFIDNLPQDVAPDAKQYLTKVQCGTESYHAENATITVSAYTV
AVHTLMQGDVSFSDKSAEQS
Download sequence
Identical sequences Q30BY6
jgi|Phyra1_1|83138|fgenesh1_pg.C_scaffold_83000034 164328.JGI83138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]