SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q31LF2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q31LF2
Domain Number 1 Region: 1-254
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.33e-82
Family Histidine biosynthesis enzymes 0.0000000982
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q31LF2
Sequence length 255
Comment (tr|Q31LF2|Q31LF2_SYNE7) ImGP synthase subunit HisF {ECO:0000256|HAMAP-Rule:MF_01013} KW=Complete proteome; Reference proteome OX=1140 OS=Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2). GN=Synpcc7942_2087 OC=Synechococcus.
Sequence
MLAKRILPCLDVKAGRVVKGVNFVDLRDAGDPVELAQAYDAAGADELVFLDIAATHEERQ
ILVDVVYRTAEQVFIPLTVGGGINDLETIRQLLRAGADKVSINSAAVRDPDLIRRASDRF
GSQCIVVAIDARRRTDPDNPGWDVYVRGGRENTGIDALTWAETVARNGAGELLVTSMDAD
GTQAGYDLELTRAIADRVEIPVIASGGAGTCEDIAEAFRTGHAEAALLASLLHYGQLTIA
EIKDHLRSAQIPTRP
Download sequence
Identical sequences Q31LF2
WP_011378309.1.45845 WP_011378309.1.95485 gi|81300896|ref|YP_401104.1| 1140.Synpcc7942_2087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]