SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q31LR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q31LR9
Domain Number 1 Region: 38-142
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.05e-18
Family Bacterial dinuclear zinc exopeptidases 0.0023
Further Details:      
 
Domain Number 2 Region: 2-51
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.00000262
Family Bacterial exopeptidase dimerisation domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q31LR9
Sequence length 148
Comment (tr|Q31LR9|Q31LR9_SYNE7) N-acyl-L-amino acid amidohydrolase {ECO:0000313|EMBL:ABB58000.1} KW=Complete proteome; Reference proteome OX=1140 OS=Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2). GN=Synpcc7942_1970 OC=Synechococcus.
Sequence
MIADRVRLLGTVRSLHPETHAGLPDWIESIIASICKTYDAHYEFHYRRGVPSVQNDETLT
RLVEAAAIEAWGQTAVERIEEPSLGAEDFSVYLEKIPGMMFRLGVGYPDRQNPPLHHPQF
EIDERALIVGVITLAYSIWRYWQPAVKG
Download sequence
Identical sequences Q31LR9
1140.Synpcc7942_1970 gi|81300779|ref|YP_400987.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]