SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q31P49 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q31P49
Domain Number 1 Region: 3-161,242-254,382-445
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.27e-22
Family FAD/NAD-linked reductases, N-terminal and central domains 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q31P49
Sequence length 585
Comment (tr|Q31P49|Q31P49_SYNE7) Uncharacterized protein {ECO:0000313|EMBL:ABB57170.1} KW=Complete proteome; Reference proteome OX=1140 OS=Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2). GN=Synpcc7942_1140 OC=Synechococcus.
Sequence
MLETLRTDVLIVGGGTGGTAAALQAARRGAQTILVSEGPWLGGMLTSAGVSAPDGNELRA
LQTGIWGAFLKALRQRQPDGLNHAWVSFFTYDPRVGSQIFADWVRELPNLKWIQGDRPRA
VIGDRDRLRGVEFERVRIEAQVVIDATELGDLLALADVPHRWGWEPQEEWQEPSAPTLAQ
LESDDRYQRYPVQSPTWVVVMADQSQSAPPIPASTSYNPDLFAGAWQTPDNLAFLDYGRL
PGDRFMINWPGPGNDYGEGLQRLIQGDRAHQEWMQEAIAHSQAFAHHIQAHWSDRYGLAR
DQFPQQAIGGGAFALQPYYRESRRVVGSSTITELDLLPLHQGQVAKLPCNASGQVSAIAI
GNYANDHHYPNWDFRLQPKSMRWGGRWTGTAFSLPYDCLLPVQTEGLLVCEKNIAVSHIA
NGATRLQPVVLGLGQAAGMAAALAVEQNCDPRSLSVRDLQEALLTDSEAPQAIVPLYDTP
PEHPDWLTRQRAYLDRPEAYPATGVHGGTAAASLISARAQTVSGQFERLGDQNYQLDDGK
TVWQLVTLDASIDQQFKALSDRLPLAVVGLINPAGHWLIVEAIHP
Download sequence
Identical sequences Q31P49
1140.Synpcc7942_1140 WP_011377880.1.45845 WP_011377880.1.95485 gi|81299949|ref|YP_400157.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]