SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q31P51 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q31P51
Domain Number 1 Region: 26-249
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 6.28e-57
Family PP-loop ATPase 0.00024
Further Details:      
 
Domain Number 2 Region: 227-329
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 2.62e-20
Family MesJ substrate recognition domain-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q31P51
Sequence length 336
Comment (tr|Q31P51|Q31P51_SYNE7) tRNA(Ile)-lysidine synthetase {ECO:0000256|HAMAP-Rule:MF_01161} KW=Complete proteome; Reference proteome OX=1140 OS=Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2). GN=Synpcc7942_1138 OC=Synechococcus.
Sequence
MLHRPLPSPSALSSDCWTPFHARLHQLLQRRSLLPTRSRLLLAVSGGQDSLALVQLLRGL
QPHWHWSLAIAHCDHGWRSDSTANAEHLRQLADQWQLPFYCQRSPEPPRSEAAARTWRYQ
VLEAIAADIDAALLVTGHTASDRAETLLYNLTRGSHLQGLASLRWQRSLSDRLTLVRPFL
GFTRAETSKMVQQFQLPVWEDSTNRDRRFARNRLRLEVLPQLRQINPQCDRHLANTAELL
ADEADWLAELTEQVYQQSLSEKGLCRSQLAQQPIALQRRVLHAFLQDQLQRSPSTVQVEE
LRQLITAPQGSCSSSLPQRRVAVVAGDWLRLQSVDD
Download sequence
Identical sequences Q31P51
1140.Synpcc7942_1138 gi|81299947|ref|YP_400155.1| WP_011377878.1.45845 WP_011377878.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]