SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q31R79 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q31R79
Domain Number 1 Region: 4-210
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.83e-54
Family Tryptophan biosynthesis enzymes 0.0000603
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q31R79
Sequence length 217
Comment (sp|Q31R79|TRPF_SYNE7) N-(5'-phosphoribosyl)anthranilate isomerase {ECO:0000255|HAMAP-Rule:MF_00135} KW=Complete proteome; Reference proteome OX=1140 OS=Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2). GN=Synpcc7942_0408; OC=Synechococcus.
Sequence
MGLRIKICGLRDPQQAIAIADLGATAIGFIAVRQSPRYVSPAQVAEIAQALQKTHPTVNR
VGVFANATAEELEAYVAAGITSLQLHGDETLADCQRWRDRFPALELIKALRIRSTADLAL
AESFTDCVDTLLLDAYHPQMLGGTGATLDWQALQAFQPSRPWLLAGGLTPENITTALSQL
HPAGIDLSSGVERSPGDKDLEKVTALFSSLARNSLLK
Download sequence
Identical sequences Q31R79
WP_011377568.1.45845 WP_011377568.1.95485 1140.Synpcc7942_0408 gi|81299219|ref|YP_399427.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]