SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q31S66 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q31S66
Domain Number 1 Region: 22-391
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.48e-117
Family GABA-aminotransferase-like 0.00000457
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q31S66
Sequence length 399
Comment (tr|Q31S66|Q31S66_SYNE7) Pleiotropic regulatory protein-like {ECO:0000313|EMBL:ABB56103.1} KW=Complete proteome; Reference proteome OX=1140 OS=Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2). GN=Synpcc7942_0071 OC=Synechococcus.
Sequence
MCSSSECPVTSIPAFNLTEQYRRIGAELETATAKVLASGGYIGGQTVADFEAAFAAAMGV
TEAVGCNSGTDALHLALRALDIGPGDEVITSPFTFFASAEAISLAGATPVLVDIEPQFFN
LDYRQIEAAITPRTKAIIPVHLFGHPAAMSEIMAIARAHNLRVIEDCAQATGATWQGQPV
GSFGDCGCFSFYPTKNLGACGDGGLVTTKNPEVADRLRSLRQHGMRVRYYHDEIGLNSRL
DALQAVILSIKLRYLDEWNQQRQAIAQRYGEAIAAIPGLVAPSVHADAVHVWHQYTVRVQ
ACGDRSRCVSHPCDRQGLCRDWLQQQLQAQGIGSMIYYPVPVHLQQAYSQLGYKTGDFPE
AERAAQEVLSLPMFPELNEDDQARVITALKDLAIAAVQS
Download sequence
Identical sequences A0A0H3K324 Q31S66
gi|56751442|ref|YP_172143.1| gi|81298882|ref|YP_399090.1| WP_011243745.1.45845 WP_011243745.1.5740 WP_011243745.1.95485 1140.Synpcc7942_0071 269084.syc1433_d

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]