SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q32L26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q32L26
Domain Number 1 Region: 15-194
Classification Level Classification E-value
Superfamily EF-hand 3.8e-35
Family Calmodulin-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q32L26
Sequence length 212
Comment (sp|Q32L26|EFCB1_BOVIN) EF-hand calcium-binding domain-containing protein 1 KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=EFCAB1; OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MNRKKLQKLTDSLTKNCKHFSKFEVKCLINLFYNLVGEVTERQGVIIGLDRNAFRNILHM
TFGMTDDMIMDRVFRGFDKDNDGCISVTEWVYGLSVFLRGTLEEKMKYCFEVFDLNGDSF
ISKEEMFHMLKNSLLKQPSEEDPDEGIKDLVEITLKKMDHDHDGKLSFADYEQAVREETL
LLEAFGPCLPDPKSQSEFEAQVFKDPNEFNEV
Download sequence
Identical sequences Q32L26
ENSBTAP00000011457 NP_001032674.1.59421 NP_001032674.1.76553 XP_005892046.1.15283 XP_010837243.1.44457 XP_014332548.1.15283 XP_019829643.1.53367 XP_019829645.1.53367 ENSBTAP00000011457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]