SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q32L50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q32L50
Domain Number 1 Region: 74-121
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000589
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 2 Region: 35-76
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000889
Family Somatomedin B domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q32L50
Sequence length 264
Comment (sp|Q32L50|SBSPO_BOVIN) RPE-spondin KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=SBSPON; OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MRTLWMALCVLARLWPGALAGCADAGRCCPGRDPACFASGWRQDRVYGTCFCDQACRLTG
DCCFDYARACPARPCIVGEWSPWSGCASQCRPTARVRRRAVQQEPQNGGEPCPALEERAG
CLEYATPQGEDCGHAFVPAFITTSAFNKERTRQAASPHWTTSTEDAGYCMEFKTESLTHH
CALENRPLTRWMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDSDGNQTLHWQAIGNPRC
QGTWKKVRRVEQCSCPAVHSFIFI
Download sequence
Identical sequences Q32L50
NP_001069337.1.59421 NP_001069337.1.76553 ENSBTAP00000022924 ENSBTAP00000022924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]