SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q32L92 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q32L92
Domain Number 1 Region: 3-186
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.15e-47
Family Calponin-homology domain, CH-domain 0.0000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q32L92
Sequence length 329
Comment (sp|Q32L92|CNN3_BOVIN) Calponin, acidic isoform KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=CNN3; OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MTHFNKGPSYGLSAEVKNKIASKYDHQAEEDLRNWIEEVTGMSIGANFQLGLKDGIILCE
LINKLQPGSVKKVNESSLNWPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQT
TLVALAGLAKTKGFHTTIDIGVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMT
AYGTRRHLYDPKMQTDKPFDQTTISLQMGTNKGASQAGMLAPGTRRDIYDQKLTLQPVDN
STISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDY
QAEYPDEYHGEYQDDYPRDYQYGDQGIDY
Download sequence
Identical sequences Q32L92
9913.ENSBTAP00000027115 ENSBTAP00000027115 NP_001033268.1.59421 NP_001033268.1.76553 XP_006057628.1.26621 XP_010858789.1.44457 XP_012001049.1.54773 XP_017901282.1.57651 XP_020725030.1.74333 ENSBTAP00000027115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]