SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q32LH8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q32LH8
Domain Number 1 Region: 17-89
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000144
Family RING finger domain, C3HC4 0.0087
Further Details:      
 
Weak hits

Sequence:  Q32LH8
Domain Number - Region: 252-283
Classification Level Classification E-value
Superfamily SAP domain 0.000152
Family SAP domain 0.0068
Further Details:      
 
Domain Number - Region: 201-233
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.00785
Family Rad50 coiled-coil Zn hook 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q32LH8
Sequence length 456
Comment (tr|Q32LH8|Q32LH8_BOVIN) RAD18, E3 ubiquitin protein ligase {ECO:0000313|Ensembl:ENSBTAP00000044535} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=RAD18 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MDSLAEPRWPPALAVMKKVDDLLRCGICFEYFNIAMMIPQCSHNYCSLCIRKFLSYKTQC
PTCCVTVTEPDLKNNRVLDELVKNLNFARNHLLQFALESPPISAASSSSKNLATKADTAV
AFRHSLKQGSKLMENFLIRESGGSASELLIKENESKLSPQKKLSSPAKTRGTPSAVKSAP
GSSEDSVLETPSTSALKQVTKVDCPVCGVKIPENHINKHLDSCLSREEKKESLRSSVHKR
KPLPKTVYNLLSDRDLKKKLKQHGLSVQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEI
VQEIENMEKTRMRFEASKLNESVMVFTKNQTEKEIDEIHSKYRQEDNKIKSSDTPSVETN
HFRQSKLDFPGKLERSRQDDSFSCTDIQEEALSSSESDSFKSSSSDIIRDLLEEEEAWEA
SHKNDFQDREISPGQNRRTRSAESAELEPRNKRNRN
Download sequence
Identical sequences Q32LH8
ENSBTAP00000044535 NP_001030372.2.59421 NP_001030372.2.76553 9913.ENSBTAP00000044535 ENSBTAP00000044535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]