SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q32N74 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q32N74
Domain Number 1 Region: 258-525
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-82
Family Protein kinases, catalytic subunit 0.000000000615
Further Details:      
 
Domain Number 2 Region: 119-245
Classification Level Classification E-value
Superfamily SH2 domain 5.22e-37
Family SH2 domain 0.0000031
Further Details:      
 
Domain Number 3 Region: 61-150
Classification Level Classification E-value
Superfamily SH3-domain 5.31e-22
Family SH3-domain 0.0000499
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q32N74
Sequence length 534
Comment (tr|Q32N74|Q32N74_XENLA) Tyrosine-protein kinase {ECO:0000256|RuleBase:RU362096} OX=8355 OS=Xenopus laevis (African clawed frog). GN=fyn OC=Xenopus.
Sequence
MGCVQCKDKEATKLTDERDNSLTQSLGYRYGTDPTPQHYPSFTVTTIPNYNNFHATAGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLNFQKGEKFQILNSSEGDWW
EARSLTTGGTGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTYLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFEALQQLVQHYSEKADGLCF
NLTVIAPNYTPQTVGLAKDAWEVARNTISLEQKLGQGCFAEVWFGTWNGNTKVAIKTLKP
GTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKDGEGRALK
LPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEYTAR
QGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGY
RMPCPQDCPNSLHELMLNCWKKDPEERPTFEYLQGFLEDYFTATEPQYQPGDNL
Download sequence
Identical sequences Q32N74
gi|80476848|gb|AAI08794|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]