SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q32N91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q32N91
Domain Number 1 Region: 49-150
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.45e-20
Family PDI-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q32N91
Sequence length 375
Comment (tr|Q32N91|Q32N91_XENLA) Uncharacterized protein {ECO:0000313|EMBL:AAI08771.1} OX=8355 OS=Xenopus laevis (African clawed frog). GN= OC=Xenopus.
Sequence
KMAAAAASDSRERTERRRRCQCRGAGLLFVSLVLLAVPRGVRSSEVSSDTSVTSVTSTDW
SQVLRGHSMILFYAPWCPACQQIQSAWESFGEKSEALGVKVVKVDVTQEPGLSGRFFVTT
LPTIFHAKDGVFRRYHGSRMVEDLQTFISEKKWEVIEPVAGWRSPSSIVMSGMASLFQLS
GWMRQLHNYFTGPLEIPSWGSYIIFIVATLLVGLLLGLMLVLIIDCCCPSKSKYEVMREE
VNEENLANLEAEAKVVPVERKPDCAANEGGSDDDNEEEDEEESGNSSEGDNEKENSNEDD
SEDSDEEEDDDDDEEEGEASNAQNVAKDSDEDSAVAGSEAEEDNVPEVSPVSPAESESES
ALRQRRVEATEGSGH
Download sequence
Identical sequences Q32N91
gi|80478581|gb|AAI08771|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]