SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q32PC4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q32PC4
Domain Number 1 Region: 27-151
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.1e-27
Family Dual specificity phosphatase-like 0.00000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q32PC4
Sequence length 167
Comment (tr|Q32PC4|Q32PC4_BOVIN) Cyclin-dependent kinase inhibitor 3 {ECO:0000256|PIRNR:PIRNR037322} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=CDKN3 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MKPPSSMQTSEFDSSDEEPIEDEQTPIQISWLPLSRVNCSQFLGLCALPGCKFKDVRRNI
QKDTDGGTPDITSCCEIMEELEICLKNNRKTLIHCYGGLGRSCLVAACLLLYLSDTVSPQ
QAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHLSSRNSLSRSVSR
Download sequence
Identical sequences Q32PC4
ENSBTAP00000041263 ENSBTAP00000041263 9913.ENSBTAP00000041263 NP_001035672.1.59421 NP_001035672.1.76553 XP_005968704.1.78601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]