SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q386B8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q386B8
Domain Number 1 Region: 313-359,410-676
Classification Level Classification E-value
Superfamily Kelch motif 4.45e-27
Family Kelch motif 0.016
Further Details:      
 
Domain Number 2 Region: 132-201,243-267
Classification Level Classification E-value
Superfamily POZ domain 5.34e-17
Family Tetramerization domain of potassium channels 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q386B8
Sequence length 729
Comment (tr|Q386B8|Q386B8_TRYB2) Uncharacterized protein {ECO:0000313|EMBL:EAN79363.1} KW=Complete proteome; Reference proteome OX=185431 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1). GN=Tb11.02.1460 OC=Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae; Trypanosoma.
Sequence
MNDRPHFYEAPDLMDEHGAPIVFDDVYSDLLSVAVEESANDGSRPVCGLEAVRPVDNEIH
SVADEGTESEGRHALDVLLYEYEHIRNAMKRCVRASHEVLRNLQQKRHRIEQQERTVRRR
TELASSSTSFPIFKLNVGGMRFHVQRETFLQFDVTLFHVLCNEQFAVQKDECGYVFFDRD
PWLFRELLFLLRERKQCLVENEVASPLVPPQDQQGDMQHHRHQRRPQELYSVGQRRLAEL
PPIERQRLLEEARYYGLNELVAELLTRQYEWRHCVFGPLPSLDLAHGCDQVQPPLLASPR
EFESQRLEEGGHTPLPPPRCCFASSVFLNGSIYLFGGFGSEGEVIGTLYRFQLKPGSMCE
AGAEIEGNDSGSCREPHGANSDAKGRHTRANACVPGRPFMWYDLVEPHREGRRGVPPPRT
GHAAASWGNCFVLVFYGNNLYHHLRDVWMYHTIQNAWYEVKVCGADVPARSGHTVTVMQG
RFYLFGGKDLFQRDARCFADVYEGLFDAEGMELTWRLASSSGEVQQADRLRQPLAACDEN
CGEPCDAPSAAYHSAVEHKGRYIIVYGGLRDSEGITNGENPGGLRGNMGVGTAPAAYDTN
LRLYVFDTLGGTWQRVQTRCAESKDQMGSDIPLTGHVAVLCHDHMYVMGSYDCTHHQRLE
VFRLSLVTLLWCRVPTSVAVGHIPPCSRALPSIVLLPPTVEAPRSVIMVFGGYNTNTCQY
LNDSYLISL
Download sequence
Identical sequences Q386B8
XP_828475.1.54365 Tb11.02.1460 5691.Tb11.02.1460 gi|71755121|ref|XP_828475.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]