SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3B7I8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3B7I8
Domain Number 1 Region: 61-106
Classification Level Classification E-value
Superfamily LysM domain 0.000000235
Family LysM domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q3B7I8
Sequence length 207
Comment (sp|Q3B7I8|LYSM2_XENTR) LysM and putative peptidoglycan-binding domain-containing protein 2 KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=lysmd2; OC=Silurana.
Sequence
MADLSPVLQPHREGGSRYGYTMFPGLECESEAELSLSLARTKTRSYGSTASVAAPLSERY
IEHRLSPSDTLQGIALKYGVTMEQIKRANKLFSTDCIFLRKSLNIPVISKKGSLFNGLGS
LDSPENETQDNCNSPTKEPALAEAHTVSIPSSAKTNQPIVRSDEELSAKDFLQRLDLQIK
RSTQAAQRLKEEDLRHDDSYATCSYQH
Download sequence
Identical sequences Q3B7I8
gi|110645648|gb|AAI18886| gi|113205522|ref|NP_001037868| gi|114150021|sp|Q3B7I8| gi|77748410|gb|AAI07590| ENSXETP00000044860 NP_001037868.1.99540 ENSXETP00000044860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]