SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3BGH5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3BGH5
Domain Number 1 Region: 1-89,121-135
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.7e-23
Family Duffy binding domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q3BGH5
Sequence length 135
Comment (tr|Q3BGH5|Q3BGH5_PLAFA) Erythrocyte membrane protein {ECO:0000313|EMBL:CAJ40012.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
DIGDIVRGRDLFRGNDEEKKQRKELDKKLKEVFGKIHKEVTTNGKNVDALKARYQDDAKK
YYSKLREDWWTANRETVWKAITCGAGQNDTYFRQTCNDDETLSHANYKCRCKNKKVTNET
DQVPTYFDYVPQFLR
Download sequence
Identical sequences Q3BGH5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]