SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3BXZ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3BXZ5
Domain Number 1 Region: 175-322
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.34e-37
Family Glutathione S-transferase (GST), C-terminal domain 0.0068
Further Details:      
 
Domain Number 2 Region: 41-161
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000176
Family Glutathione S-transferase (GST), N-terminal domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q3BXZ5
Sequence length 324
Comment (tr|Q3BXZ5|Q3BXZ5_XANC5) Putative glutathione transferase {ECO:0000313|EMBL:CAJ22268.1} KW=Complete proteome OX=316273 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10). GN=XCV0637 OC=Xanthomonadaceae; Xanthomonas.
Sequence
MGLLVDGKWQDRWYDTSKSEGRFERSQSQFRNWVTRDGSAGPHGQGGFKAASGRYHLYVS
LACPWAHRTLIFRRLKGLESMIDVSIVHWLMRENGWTFADGPGVVGDTESHAQYLYEVYL
KADPHYSGRVTVPVLWDRERKTVVSNESADIIRMFNSAFDAIGAADGDFYPQPLREQIDA
VNARVYDTVNNGVYKAGFATTQAAYDEAVVPLFESLDWLEARLSAQRYLCGDRLTEADWR
LFTTLVRFDAVYVGHFKCNLRRIADYPQLSGFLRELYQMPGIADTVNFQHIKGHYYQSHD
TINPNGIVPMGPLLDLDAPHGRGG
Download sequence
Identical sequences Q3BXZ5
316273.XCV0637 gi|78046193|ref|YP_362368.1| WP_011346264.1.100156 WP_011346264.1.331 WP_011346264.1.46449 WP_011346264.1.46677 WP_011346264.1.60785 WP_011346264.1.89212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]