SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3ILW7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3ILW7
Domain Number 1 Region: 2-241
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.39e-35
Family Extended AAA-ATPase domain 0.0087
Further Details:      
 
Domain Number 2 Region: 238-318
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000024
Family MarR-like transcriptional regulators 0.062
Further Details:      
 
Weak hits

Sequence:  Q3ILW7
Domain Number - Region: 371-442
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.000225
Family MRR-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q3ILW7
Sequence length 463
Comment (tr|Q3ILW7|Q3ILW7_NATPD) DUF234 domain protein {ECO:0000313|EMBL:CAI50903.1} KW=Complete proteome; Reference proteome OX=348780 OS=NBRC 14720 / NCIMB 2260 / Gabara) (Halobacterium pharaonis). GN=NP_6246A OC=Natronomonas.
Sequence
MTFYDREAELDTLSDAVESPGADFVVVYGRRRVGKTELLKEFCANRPHIYFLAAQEAEHR
QREKFLDQVADYFDERVPRIDGWDEAFEYLGEQLQREDLVVVIDEFPYLVAENDSLPSYV
QGFVDQELDGTDSMIVLCGSSVSTMESEILGHESPLYGRRTAQLDVTPFSFQQAREVISY
DIQDAIRSYAVTGGTPMYLTLFDYTQSLAANIQSHVLSPSAVLYNEPEFLLRTELRNPAR
YMSILEAVALGHTTPNEISGATGIDSGPLSKYLQTLRRLRLIERDVPVMASGKKSKRSRY
RVADEFLRFWFRYVEPNRSSIEEAPEIVYDGTIEPDLPTHVATTFEDVCQEAVWEGIRRG
TFDPYSEVGRWWYGEEEIDIVGLAPNDDRVLLAECKWTTDPVGEDLVESLRAKAEHVRWG
PPDRDEQFALFSKSGFVDGLEAQLDDSWSLFTVADIDDLLTPS
Download sequence
Identical sequences Q3ILW7
gi|76803479|ref|YP_327748.1|NC_007427 348780.NP6246A gi|76803479|ref|YP_327748.1| WP_011324500.1.57290 NpR82

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]