SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3ILY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3ILY9
Domain Number 1 Region: 5-87
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000248
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.036
Further Details:      
 
Domain Number 2 Region: 73-148
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 0.000000000282
Family Lrp/AsnC-like transcriptional regulator C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q3ILY9
Sequence length 165
Comment (tr|Q3ILY9|Q3ILY9_NATPD) Lrp/AsnC family transcription regulator {ECO:0000313|EMBL:CAI50880.1} KW=Complete proteome; Reference proteome OX=348780 OS=NBRC 14720 / NCIMB 2260 / Gabara) (Halobacterium pharaonis). GN=NP_6200A OC=Natronomonas.
Sequence
MTGELDERDFRILCAIAEHETFSSEDLHEETGIPKSTVHYRIQNMKDEGVIKNELFEFDR
EKIGIEITLISEVWAEFGEGYHDTVGEKLSEIEGVNQVYFTMGDTDFVAIARLTSRDMVE
QLVEDYESIDEIQRTSSKFAISTIKEDISISALGDYSVETLLDSD
Download sequence
Identical sequences Q3ILY9
348780.NP6200A gi|76803457|ref|YP_327726.1| WP_011324478.1.57290 gi|76803457|ref|YP_327726.1|NC_007427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]