SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3IM08 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3IM08
Domain Number 1 Region: 33-107
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000251
Family Vacuolar sorting protein domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q3IM08
Sequence length 193
Comment (tr|Q3IM08|Q3IM08_NATPD) HTH domain protein {ECO:0000313|EMBL:CAI50860.1} KW=Complete proteome; Reference proteome OX=348780 OS=NBRC 14720 / NCIMB 2260 / Gabara) (Halobacterium pharaonis). GN=NP_6160A OC=Natronomonas.
Sequence
MTSTYIKTKPERCCMTEDESDSEGLMERQTTGEDRVRMVARQLSEPQTANWIASEAGWSH
EPTKRVLERLVDDGILHCDESGTHTTYYPDYRRQAMQEAMRLRDSGHTVEELTDRLADMK
TQIRDWEDEFGVESPNQLRGTLADESLDGGEEDRRRDIAREWEHLQRRIQIVGFAIREWD
FLAPTTEPAEASS
Download sequence
Identical sequences Q3IM08
gi|76803438|ref|YP_327707.1|NC_007427 gi|76803438|ref|YP_327707.1| WP_011324459.1.57290 348780.NP6160A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]