SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3IT59 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3IT59
Domain Number 1 Region: 115-428
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.86e-90
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000564
Further Details:      
 
Domain Number 2 Region: 10-100
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.29e-22
Family Anticodon-binding domain 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q3IT59
Sequence length 433
Comment (sp|Q3IT59|SYDND_NATPD) Non-discriminating aspartyl-tRNA synthetase {ECO:0000255|HAMAP-Rule:MF_02075} KW=Complete proteome; Reference proteome OX=348780 OS=NBRC 14720 / NCIMB 2260 / Gabara) (Halobacterium pharaonis). GN=NP_1168A; OC=Natronomonas.
Sequence
MENRTYTADAEPGETVTVAGWVHEVRDLGGIAFLILRDTTGQIQVKFEKDEMDDELVETG
LNVARESVITVSGDVEEEPRAPTGVEVTPETVEVLSEADTELPLDPTGKVDAELSTRLDN
RTLDLRSEEGQAIFEIRAEVLRAVREAFRDANATEINTSKIVATGTEGGTELFPITYFGE
EAFMNQSPQLFKQLVAGSNIERVFEIGPIFRAEEHNTPRHLNEATSIDFEGAFCDHTDAM
DVCEQVVTAAYEAVAENCTDQLEALGITEEFEVPETPFPRLSYEEAIERINATGELDEQL
VWGDDLPTEGEKALGDDVGGHYFITDWPAEIKPFYIMDHEDGELSTGFDMMHPRMELVSG
GQREHRREELIAGFEQQGLEPEAFEYYTKMFKYGMPPHAGWGLGGERLLMTMLDLDNIRE
AVLFPRDRQRLSP
Download sequence
Identical sequences Q3IT59
WP_011322311.1.57290 gi|76801236|ref|YP_326244.1| 348780.NP1168A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]