SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3JB67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3JB67
Domain Number 1 Region: 68-198
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 6.82e-32
Family Glutathione S-transferase (GST), C-terminal domain 0.0002
Further Details:      
 
Domain Number 2 Region: 2-71
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.86e-20
Family Glutathione S-transferase (GST), N-terminal domain 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q3JB67
Sequence length 200
Comment (tr|Q3JB67|Q3JB67_NITOC) Maleylacetoacetate isomerase {ECO:0000313|EMBL:ABA57929.1} KW=Complete proteome; Reference proteome OX=323261 OS=C-107). GN=Noc_1440 OC=Chromatiaceae; Nitrosococcus.
Sequence
MRIALNLKGIGYHSRFVHLLRRGGEQRQPAYLKLNPQGLVPALVDGGTVITQSLAIIAYL
DERYPQPPLLPTDVKARAYVRSLAQLVACDIHPLNNLRVRQYLATCGRHSEAEWQAWYRH
WIQEGFKALEAQLAAHPAADRYCYGNYPTVADICLVPQVYNAHRFNCQLDDYPLLSSIYR
HCSVLKAFQEAAPECQLDAS
Download sequence
Identical sequences Q3JB67
323261.Noc_1440 gi|77164934|ref|YP_343459.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]