SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3JB95 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3JB95
Domain Number 1 Region: 40-105
Classification Level Classification E-value
Superfamily Coronavirus S2 glycoprotein 0.0000837
Family Coronavirus S2 glycoprotein 0.01
Further Details:      
 
Weak hits

Sequence:  Q3JB95
Domain Number - Region: 58-205
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0133
Family Formin homology 2 domain (FH2 domain) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q3JB95
Sequence length 216
Comment (tr|Q3JB95|Q3JB95_NITOC) Uncharacterized protein {ECO:0000313|EMBL:ABA57901.1} KW=Complete proteome; Reference proteome OX=323261 OS=C-107). GN=Noc_1412 OC=Chromatiaceae; Nitrosococcus.
Sequence
MLNITLRAFLTSLFLLLLTGCQAAYYKTMEEFGYHKRDILADRVEEVRDTQIEAKEQFQS
ALEQFSSVVNYDGGDLEDLYEELNGEYQASQKKAEAVHDRIASVENVAGALFQEWEEELD
QYDNPSLRRSSQQQLTQTRTRYDKLIRAMKRAEAKIEPVLTTFHDQVLFLKHNLNARAIA
SLQGELSTIETDVNRLVQEMEAAIDEANEFIKTLES
Download sequence
Identical sequences A0A0E2Z251 Q3JB95
gi|77164906|ref|YP_343431.1| WP_002810835.1.20919 WP_002810835.1.60716 WP_002810835.1.77844 WP_002810835.1.91979 323261.Noc_1412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]