SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3JEK0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3JEK0
Domain Number 1 Region: 21-91
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000897
Family Thioltransferase 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q3JEK0
Sequence length 96
Comment (tr|Q3JEK0|Q3JEK0_NITOC) Glutaredoxin 2 {ECO:0000313|EMBL:ABA56746.1} KW=Complete proteome; Reference proteome OX=323261 OS=C-107). GN=Noc_0216 OC=Chromatiaceae; Nitrosococcus.
Sequence
MAANPASVNYPMTITTHSKRLILYHTAGCHLCEEARQLLAQLPEITTEEVDIGNDPLLVE
RYGTRIPVLLQPDSGLTLNWPFTLEAIHQWTHAGQR
Download sequence
Identical sequences Q3JEK0
323261.Noc_0216 gi|77163751|ref|YP_342276.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]