SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3M1M8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3M1M8
Domain Number 1 Region: 7-228
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 2.62e-73
Family Acetyl-CoA synthetase-like 0.00000278
Further Details:      
 
Domain Number 2 Region: 208-280
Classification Level Classification E-value
Superfamily ACP-like 2.62e-20
Family Peptidyl carrier domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q3M1M8
Sequence length 314
Comment (tr|Q3M1M8|Q3M1M8_ANAVT) Phosphopantetheine-binding protein {ECO:0000313|EMBL:ABA25093.1} KW=Complete proteome OX=240292 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937). GN=Ava_C0004 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence
MSPNPDEWSYHPPIGTPIANTQIHILDSHLKPVPIGVIGELYIGGVSLARGYLNRPDLTN
ERFIPDPFSKETGSRLYKTGDLARYLLDGNIEYLGRIDNQVKVRGFRIELGEIEAVLNQH
PDVNKAVVLAQTDTTNQQRLIAYIVSNQAVQEATSDFHSFLQKKLPEYMIPSAFIFLKSL
PLTSNGKIDRQALLNINLDDYLFKANFIAPRTAAEKVIANIWKQTLGVNQIGIYDNFFAL
GGHSLLATQVFFKLNKIFQVELSLSQLFETPTVAGLLEVITQQLGGVDVVENIAQILLEI
QQFSPEEVREMLDK
Download sequence
Identical sequences Q3M1M8
gi|75812665|ref|YP_320282.1|NC_007412 240292.Ava_C0004 gi|75812665|ref|YP_320282.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]