SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3M2E1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3M2E1
Domain Number 1 Region: 15-259
Classification Level Classification E-value
Superfamily PP2C-like 0.000000000123
Family PP2C-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q3M2E1
Sequence length 262
Comment (tr|Q3M2E1|Q3M2E1_ANAVT) Uncharacterized protein {ECO:0000313|EMBL:ABA24845.1} KW=Complete proteome OX=240292 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937). GN=Ava_B0133 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence
MGWKAIARSAMGTSHQIQKISCQDYGCYHIFNDVIVGVVSDGAGSAKYSDIGSKLAVKTV
IKCFSEINKFPNKQEELEKKFSQPLSTPEVEQFFIKVVAQVLQELENHANNENYSINDLA
CTLLVFIATPYWLAAMQIGDGFIVVRLQDSDYQLLFEPDKGEFANETTFLTSKDVIKEMQ
IKVISGEQSFISASTDGLEKVAIRLRDWQPFTPFFKPLEEYLQETANPESEDHYLVNFLN
SERLNTRTDDDKTLLLCLFNRK
Download sequence
Identical sequences A0A1W5CG26 Q3M2E1
gi|75812415|ref|YP_320034.1|NC_007410 240292.Ava_B0133 gi|75812415|ref|YP_320034.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]