SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3M3H2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3M3H2
Domain Number 1 Region: 180-326
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000000792
Family PBS lyase HEAT-like repeat 0.0037
Further Details:      
 
Domain Number 2 Region: 19-172
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000186
Family SMI1/KNR4-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q3M3H2
Sequence length 362
Comment (tr|Q3M3H2|Q3M3H2_ANAVT) PBS lyase HEAT-like repeat protein {ECO:0000313|EMBL:ABA24464.1} KW=Complete proteome OX=240292 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937). GN=Ava_4867 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence
MSLLTETLERIFKHLQQHRPEVASLLKPGKKIEEIQSQINNLPFHLPEEVYELYQWHNGI
DFTNISRISLPVDISFIPGFDFLPLEQAIEDSQEIEEFRHEYTSPEDENCHKPWFPIFGS
DDLEYFLVFGNSDNNKYSSIMHCHLGGGSLPKLKYPNLTTFMLIVAECYETNAYYLTQPS
EDNYFRVFLEENPKQFAEIERKYFLEELEELIKAISQPKCLLSNNIFNSLCRFKDPRFVE
PMIHILHLPLSEVDNEEENISIRISAAIILGEIGDLRAVEPLMRALESRLKEDRGYSVAN
NAAEALRKLGDPRAIEPLKRFVQNNQQYLPTFIPSTSWLERIALQEALEQANWAIKELEK
II
Download sequence
Identical sequences Q3M3H2
240292.Ava_4867 gi|75911063|ref|YP_325359.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]