SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3M3I3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3M3I3
Domain Number 1 Region: 3-379
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.25e-100
Family Cystathionine synthase-like 0.000000313
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q3M3I3
Sequence length 389
Comment (tr|Q3M3I3|Q3M3I3_ANAVT) Aromatic amino acid beta-eliminating lyase/threonine aldolase {ECO:0000313|EMBL:ABA24453.1} KW=Complete proteome OX=240292 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937). GN=Ava_4856 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence
MQIYLDYSATTPTCTEAIAVMQSVLTQQWGNPSSLHEWGQRATTIVEQARVQVAGLINAA
NPESIIFTSGGTEANNLAIMGVVRMQNVPQHIIISSVEHSAISEPANLLEKWGWEVTRLG
VDNTGRVNPEDLKAALRHNTVLVSVIYGQSEIGTVQPIAELGKITQQHGALFHTDAVQAV
GRLPIDVQQLPVDLLSLSSHKLYGPQGVGALYIRPGVELLPLLNGGGQERGLRSGTQAVP
IIAGFGVAAEIAAEELSIEIPRLMKLRDRLFAQLADVPGLIPTGDRENRLPHHVSFYLEQ
ADGEKLSGKTLVRHLNLAGIGISAGAACHSGKLSPSPILLAMGYSTKAALGGIRLTLGRE
TTAADVDWTAMVLKQILQRLVPGELVISH
Download sequence
Identical sequences A0A1W5CAR3 Q3M3I3
gi|75911052|ref|YP_325348.1| 240292.Ava_4856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]