SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3M3K5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3M3K5
Domain Number 1 Region: 1185-1583
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.23e-82
Family GABA-aminotransferase-like 0.0000107
Further Details:      
 
Domain Number 2 Region: 14-129,159-385,417-438
Classification Level Classification E-value
Superfamily Thiolase-like 4.1e-82
Family Thiolase-related 0.00029
Further Details:      
 
Domain Number 3 Region: 536-669,729-826
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 3.4e-70
Family FabD-like 0.00032
Further Details:      
 
Domain Number 4 Region: 917-1009
Classification Level Classification E-value
Superfamily ACP-like 0.0000000000000432
Family Acyl-carrier protein (ACP) 0.03
Further Details:      
 
Domain Number 5 Region: 667-727
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.000000000811
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q3M3K5
Sequence length 1646
Comment (tr|Q3M3K5|Q3M3K5_ANAVT) Beta-ketoacyl synthase {ECO:0000313|EMBL:ABA24431.1} KW=Complete proteome OX=240292 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937). GN=Ava_4834 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence
MVNMKTVENQEPLDGVAIVGMVGRFPGAKNVQEFWGNLCAGKESTTFFQDEELDPSIDPH
LVQDPSYVKARGIIPGGETFDAAFFGINPREAEVMDPQSRVFLELVYEALENAGYDAEAY
SGLIGLYAGCGQNTYFANHICGRQEIIDRVGEFQTMLANEKDFLTTRAAHKLNLKGPAVS
ISTACSTSLVAVIQACQSLSNYQCDMALAGGVSMTTPQNSGYIAQEGTMLSGDGHCRPFD
AKSQGTMFNNGAGLVVLKRVEDAIQDGDRIYAVIRGFGINNDGADKVSFTAPSVDGQAEA
IAMAQAYANFHPETISYIEAHGTATSLGDPIEIEALTQAFRIHTNSKQFCAIGSLKSNVG
HLVAAAGVAGLIKTALALYHQQIPPSLNFEAPNPNIDFANSPFYVNTQLTPWPQGETPRR
AGVSSFGVGGTNAHIVLEEAPAILPSNLSRPSQLLLLSAKTSTALETATVNLQEHLRNNA
SINLADVAHTLQRGRKAFNYRRFVVCQNTKEAITTLQSLEPKRVFTRHTQVRDPEIAFMF
PGQGSQYVNMGFNLYSREIVFRQVVDQCAEILKPILGRDLREIIYPVATDIETASTALQQ
TCFTQPALFVVEYALAQLWQSWGVKPQAMIGHSIGEFVAACLAGVFSLEDALMLVANRGR
LMWELPRGAMLSVRLSAPEVEKRLAGELAIAAINSPSLCVVSGTTEAIAAWQTQLETAEI
VCRLLHTSHAFHSPMMEAIVAPFAELVGKVKLSPPQIPFVSSVTGDWITPEEATNPMYWA
QHLRQTVRFADGVKTLWQQPERLLLEVGPRTTTTTLARQQAKDIKQQITIASLSDNADNE
AEWTALLQAMGQLWLAGVTINWNNFYQEERRQRIPLPNYPFERQRFWIDPLPHPNRNTNH
KPAHYQLEKTQTMSAQTTLISLLKEIIEETSGLEIASVDASTTFLEMGLDSLSLTQVGLA
LKKKFKVKVSLRHLLEVYPNLATLADFLQQNLSAEALSALVPSETTSPSATLSLQEVSTN
GSNGKNGKNGSTPSPMLLVPPTSTNGNGSKNGSLPQVSLPNVASSALEGVINQQLQIMAQ
QLALLGNNSQPVTVPAVNGQNNGVKSEKPVTQSNQKPEPQDSTENLPKKVFGAGARIETT
QTKTLTPQQRTYLDSIIQRYTQRTQKSKEYTQTNRPHLADPRSVSGFNPTMKEMVYPIVV
SRSSGSKLWDIDGNEYVDLSNGFGLNLFGWSPAFVTEAIEAQLKLGMEIGPQTPLVGEVA
KLMCEITNFDRAAFCNTGSEAVLGAMRLARTITGRNLIAIFSGGYHGILDEVIVRGTKKL
RSIPAAPGIPQEKVDNILVIDYDAPDALDILKSRADELAGVMVESVQSRRPEYQPREFLQ
QLRQFTEQEDIALIFDEIVTGFRIHPGGAQAHFGIKADIATYGKIVGGGLPIGVIAGKSK
YMDALDGGFWQYGDDSVPEVGVTYFAGTFVRHPLALAAAKAVLQHLLKNGPSLQQQLNAK
TDQFVVELTDYFQQMQAPYTVHNFGSLFMVKSAPEFLYGDLLFYLMRDKGVHIWDHRPCF
LTTAHSDADLSLAMAAFKESIAEMQSAGFFSAPTPTTKGSPESSKNLRNRPPQPGAKLGR
DPEGNPSWYVPDPQRPGKYLQVSSVS
Download sequence
Identical sequences Q3M3K5
gi|75911030|ref|YP_325326.1| 240292.Ava_4834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]