SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3M5N6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3M5N6
Domain Number 1 Region: 462-1020
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 6.02e-176
Family Acetyl-CoA synthetase-like 0.00000000108
Further Details:      
 
Domain Number 2 Region: 229-492
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 3.45e-72
Family NRPS condensation domain (amide synthase) 0.033
Further Details:      
 
Domain Number 3 Region: 1748-1998
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 1.1e-52
Family NRPS condensation domain (amide synthase) 0.029
Further Details:      
 
Domain Number 4 Region: 1570-1747
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 7.34e-50
Family NRPS condensation domain (amide synthase) 0.021
Further Details:      
 
Domain Number 5 Region: 44-221
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 2.78e-49
Family NRPS condensation domain (amide synthase) 0.034
Further Details:      
 
Domain Number 6 Region: 1274-1524
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 8.34e-43
Family NRPS condensation domain (amide synthase) 0.034
Further Details:      
 
Domain Number 7 Region: 1083-1284
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 3.45e-38
Family NRPS condensation domain (amide synthase) 0.021
Further Details:      
 
Domain Number 8 Region: 1001-1070
Classification Level Classification E-value
Superfamily ACP-like 2.45e-19
Family Peptidyl carrier domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q3M5N6
Sequence length 2033
Comment (tr|Q3M5N6|Q3M5N6_ANAVT) Non-ribosomal peptide synthase {ECO:0000313|EMBL:ABA23700.1} KW=Complete proteome OX=240292 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937). GN=Ava_4099 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence
MEQLSPQKRELVLQKLLAQQSSTINNKPKLPRIEAVSSDKLIPLSFPQQRLWFLDQMEGN
SAAYNMAAAVEITGNLQVSILENIIAEIIQRHAILRTNFKNVDDNAVQIIAPHLTINIPV
IDLQTLPVAEQFAEVECLAIAEQLKPFDLANDCLLRVTLLQLAPESYVLLVTMHHIVSDG
WSMGVFIQEFSTLYTAFSQNQPSLLPELAIQYADFAHWQRQCLQGEVLENQLNYWRQQLA
GIPPILELPTDRPRPPVQTFQGQTLYFELDQNLTKQLNILCQKSGTTMFMTLMAAFATLL
YRYSRQSDIVIGSPIANRDRQETFPLIGLFVNTLVLRTNLEGNPSFAELLQKVKQVALDA
YAHQDVPLERLVEALQPERSLSHMPLFQVAFAMQNAPMGKLELPNLSLNLLKIENRTAKF
DLALSMQETESGLLGEWEFNTDLFDATTISRMARHFQTLLENIVANPQQRIAEVSLLSAS
EQHQLLVDWNNTTTDYPQGKCIHQLFEEWVEQTPDAVAVVFENQQITYKELNHRANQLAH
QLQTLGVKPDVLVGICVERSLEMIVGLLGILKAGGGYVPLDPNYPSDRLAFMLNDAQLPV
LLTQQQLVEKLPEHQAIAICLDADWNEIAKNNSFNPTSTVTTANLAYVIYTSGSTGKPKG
VMVEHTGLCNLAKAQIQTFDVQTSSRILQFASFSFDASIFEVVMALGTGARLYLGTKESL
LPGSSLIQLLQKYGITHITLPPSALAVLPADELPALQTIIVAGEACPPDLVERWSRGRRF
FNAYGPTEATVWSTVAECSSNSTNKPPIGRPITNTQIYLLDQDLQPVPVGVPGELHIGGI
GLARGYLNRPELTQQKFIPHPFSNEPEARLYKTGDLARYLSDGNIEYLGRIDHQVKLRGF
RIELGEIEALLSQHPGVIQNTLIIREDIPGSQRLVAYTVANPDQIPTISELRQFLKERLP
EYMVPSAFVMLDTLPLTPNGKVDRRALPAPESRPELAVNFVAPRTPQEEKLAAIWADVLR
LQQVGIHDNFFEIGGDSILSLQIIARANQAGIQLNIKQLFQHQTIAELAAVANTIPSITA
EQGLITGSLPLTPIQHWFFDQNLPQPAYFNQSVLLEVPNDLKLEILESALQQLLLHHDAL
RLRFVQEGESWSQTHADANATVALTCVDLSEKAPQAQQTALETTANQLHASLNLSQQLMQ
AALFHFGATQSARLLIIVHHLAVDGVSWRILVEDLFHAYQQLNRGETVQLPAKTTSFKEW
SQRLTEYSHSEALAGELDFWLGQSSGSIALPVDYPQAVNTVASSAQVSVSLDIEKTRALL
QEVPAIYNTQINDVLLTALVQSFAQWTGESSLLVDLEGHGREELFADIDLSRTVGWFTCL
FPIKLELAAIANVGKTLKSIKEQLRPCQKRGINYGILRYLNPNPAIRHQLTTAPQAQVSF
NYLGQFDQELSESGAWKLAQESAGNEQGISGDRTHLLEVNALVASGKLQLNWTYSQNIHQ
TSTIEALAAGFINALTEIIHHCQSTDVGGYTPSDFPEAELTQEYLDNLVGEMANRDTASH
KKNIESIYPLSPMQQGILFHSLYDPESGVYCEQLSCTLHGSINTTAFAQAWQRVVERHSA
LRTFFVWDNLDQPHQVVCKTVNLPFAVDDWRSLSPTEQQEKLTAFQEADRNKGFELNQAP
LMRCSLIQTADDTYEFVWTFHHLLIDGWSLPVVVQEAFAFYEAANQGHDLYLKTPRPFRD
YITWLQQQDLSQAKEFWQRSLQGFTAPTPLMADKSIVHNSQQQQTYHEQHIQLPQALTTQ
LESLARQNQLTLNTLVQGIWALLLSHYSNQKDVVFGTTVSGRPPALVDVETMVGMFINAL
PVRVQVSEDEQILPWLKDLHTRQVEREQYSYTPLVEIQRVSEIASGTPMFETNVAFYNYP
VDPALQNSSSGLKITNISNYERTKYPLMLVIMPGENISVGLSYEGNRFNHETIADILENF
ATVANKITEQPDAKLQTVAEILVQADKQKQLIKDQKLAATAINKLHKFKRKSA
Download sequence
Identical sequences Q3M5N6
240292.Ava_4099 gi|75910299|ref|YP_324595.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]